DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:255 Identity:84/255 - (32%)
Similarity:119/255 - (46%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQ---GISGAHSCGGAIINETFVLTAAHCVENAFIP--WLVVVTGTN 96
            |||||..|:.|..|:.:|||   |....|.|||.::.|.:|||||||.::|..|  |..|: |||
Human    77 RIIGGTEAQAGAWPWVVSLQIKYGRVLVHVCGGTLVRERWVLTAAHCTKDASDPLMWTAVI-GTN 140

  Fly    97 KYNQPGGRY------FLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGD- 154
            ..:   |||      .:|||.||.|:......|||||..|.:.:.:::..|||.||....|..| 
Human   141 NIH---GRYPHTKKIKIKAIIIHPNFILESYVNDIALFHLKKAVRYNDYIQPICLPFDVFQILDG 202

  Fly   155 --EVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK------------ALLSNDEDCDVGHICTF 205
              :..::|||.|...|.:...||...:.|:....|.            :..:.|||         
Human   203 NTKCFISGWGRTKEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDED--------- 258

  Fly   206 SRLGEGA---CHGDSGGPLV------SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
                 ||   |.|||||||:      ...:::|:.::|..|. .|.|.|:....||:.|:
Human   259 -----GAFDTCRGDSGGPLMCYLPEYKRFFVMGITSYGHGCGRRGFPGVYIGPSFYQKWL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 83/253 (33%)
Tryp_SPc 38..258 CDD:238113 83/254 (33%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63
Tryp_SPc 78..316 CDD:238113 83/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.