DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and f10

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:261 Identity:88/261 - (33%)
Similarity:123/261 - (47%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVV 91
            ||.|    |.||:.|.....|..|:|..|...:....|||.|:.|.|:|:||||:..:..  :.|
Zfish   238 STAG----DGRIVNGVECPPGDCPWQALLINENNMGFCGGTILTEHFILSAAHCMNESLS--IRV 296

  Fly    92 VTGTNKYNQPGGRYFLKAIH------IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP---- 146
            |.|......|.||   :|.|      ||.||.....||||||::|.:||.:.:...|..||    
Zfish   297 VVGEYDTLVPEGR---EATHDVDEILIHKNYQPDTYHNDIALIKLSKPIKFTKYIIPACLPEMKF 358

  Fly   147 --LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRL 208
              .|.||. |:.:::|:|.....|.|...||.|.:.||...:|  :.|::........|. :.:.
Zfish   359 AERVLMQQ-DDGLVSGFGRVREGGLSSTILQKLTVPYVNRAKC--IESSNFKISGRMFCAGYDQE 420

  Fly   209 GEGACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNSKCTGF 268
            .:.||.||||||.|    :..::.|:|:||..|| .|...|:..|..|..||.|.|:.....||.
Zfish   421 EKDACQGDSGGPHVTRFKNTWFITGVVSWGEGCARKGKYGVYTQVSKYIMWINNAMTKVMPETGA 485

  Fly   269 S 269
            |
Zfish   486 S 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/235 (33%)
Tryp_SPc 38..258 CDD:238113 78/237 (33%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 77/235 (33%)
Tryp_SPc 245..474 CDD:238113 78/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.