DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33225

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:303 Identity:80/303 - (26%)
Similarity:131/303 - (43%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFA-PYQISLQGISGAHSC 64
            ::.:|||..|.|...:..:.:......|.....:.:|::||..| |.|| |:.:.:.|.:... |
  Fly    20 VAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDA-DRFANPWMVMVLGENNVF-C 82

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHC-------NYDNPEMH 122
            .|::|...||||:|.|:.:  :|..|::          |.|........|       :.|...:|
  Fly    83 SGSLITRLFVLTSASCLLS--LPKQVIL----------GEYDRNCTSADCTSIRQVIDIDQKIIH 135

  Fly   123 N----------DIALLELVEPIAWDERTQPIPLPLVPMQPGDEV---ILTGWGSTVLWGTSPIDL 174
            .          |||||.|.:.::..:..:||.|. |..|.|..|   ..||||:|. |......|
  Fly   136 GQFGLETVKKYDIALLRLAKKVSISDYVRPICLS-VDRQVGRSVQHFTATGWGTTE-WNEPSTIL 198

  Fly   175 QVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLG---EGACHGDSGGPL--------------V 222
            |.:.|..:..:.||..|.  ::.|...:|    :|   :..|.||:||||              .
  Fly   199 QTVTLSKINRKYCKGRLR--QNIDASQLC----VGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNK 257

  Fly   223 SNGYLVGLVNWGWPCATGVPDVHASVYFYRDWI-RNVMSGNSK 264
            |..:|:|:|::|....:|: .|:.:|..|.||| |.:...|::
  Fly   258 SRAFLIGIVSYGSSSCSGI-GVYTNVEHYMDWIVRTINKSNTE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/255 (27%)
Tryp_SPc 38..258 CDD:238113 72/258 (28%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 70/255 (27%)
Tryp_SPc 57..292 CDD:238113 71/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.