DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33226

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:121/260 - (46%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQIS-LQGISGAHSCGGAIINETFVLTAAHCVE-----------NAFIPW 88
            ::|:||..|:....|:.:. ||  .|.|.|||::|:..||||||||..           :...|.
  Fly    45 EQILGGHNADIKLHPWMVQILQ--RGYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPR 107

  Fly    89 LVVVTGTNKYNQP-GGRYFLKAIHIHCNYDNPEMHN-DIALLELVEPIAWDERTQPIPLPLVPMQ 151
            .:.   :::|..| |....:|.|.:|.:|  .:.|| ||||..|.:|:.::.:|:||.:    :|
  Fly   108 YLC---SSQYCSPFGPEIDVKRIFLHSSY--RDYHNYDIALFLLAKPVRYNVQTRPICV----LQ 163

  Fly   152 PGDEVIL------------TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG--HI 202
            ..::..|            ||||.|....||.| ||...|.::..:.|..:.    |..:|  ||
  Fly   164 TSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTI-LQTTSLFHLDRKFCAQIF----DRKIGWPHI 223

  Fly   203 CTFSRLGEGACHGDSGGPL--------VSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVM 259
            |. .......|.|||||||        |....|.|::::|.|....| .|..:|..|.:|||:::
  Fly   224 CA-GHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV-TVFTNVLRYSNWIRDIV 286

  Fly   260  259
              Fly   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/253 (30%)
Tryp_SPc 38..258 CDD:238113 79/255 (31%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 79/255 (31%)
Tryp_SPc 47..282 CDD:214473 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.