DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33458

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:261 Identity:75/261 - (28%)
Similarity:109/261 - (41%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV--ENAFIPWLVVVTGTNKYN 99
            ||.||:.:.....|:...|. |:....|||:::|..||||||||.  :||.:   :|..|.|..:
  Fly    37 RITGGRDSPLMLNPWLAYLH-INSKFICGGSLLNHWFVLTAAHCFRDKNAKV---LVRLGENDAS 97

  Fly   100 Q-----------PGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG 153
            |           |...|.:....||..|.....: ||||.:|...:.:.:..:||.|.|   .|.
  Fly    98 QKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYY-DIALAKLNRYVVYTDSIRPICLML---NPN 158

  Fly   154 DEV--------ILTGWGSTVLWGTSPID--LQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRL 208
            .:|        |:||||:|   ..|.:.  ||:..:..:....|:....  ...|..|||.    
  Fly   159 WQVYVDTIRYFIITGWGAT---NASEVSDKLQLTRIPQIDRFTCRYWFG--YMVDRTHICA---- 214

  Fly   209 GEGACH---GDSGGPLVS--------NGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGN 262
            ||...:   |||||||.|        ..:..|:|:.......|| .|..::..|.:||...:..|
  Fly   215 GESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGV-SVFTNILSYSNWIHRTIITN 278

  Fly   263 S 263
            |
  Fly   279 S 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/251 (28%)
Tryp_SPc 38..258 CDD:238113 72/253 (28%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 71/251 (28%)
Tryp_SPc 38..274 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.