DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33462

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:275 Identity:60/275 - (21%)
Similarity:101/275 - (36%) Gaps:89/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN- 99
            :|.:..:.|::   |:...|:...|.| |.|.:||..|||||||||.:.    |::.....:|| 
  Fly    37 ERSVNAKLAQN---PWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDD----LLITVRLGEYNT 93

  Fly   100 ------------QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP--M 150
                        :|...|.:.....|..|:..:..|||.:|.|...:.:....:||.:....  .
  Fly    94 KTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQ 158

  Fly   151 QPGDEVILTGWGSTVLW------GTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLG 209
            :|.|::.   |.:|.:|      .||.: |:.:.:...|...|..:        .|...||.::.
  Fly   159 EPIDQLT---WFTTTVWRETAANATSKV-LRTMNIDRQPKETCSEI--------YGWNMTFEQIC 211

  Fly   210 EG-----ACHGDSGGPLV-------------------------SNGYLVGLVNWGWPCATGVPDV 244
            .|     .|..|||.|.:                         ::|.|:.|::            
  Fly   212 AGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLS------------ 264

  Fly   245 HASVYFYRDWIRNVM 259
                  |.|||:.|:
  Fly   265 ------YADWIKRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/268 (21%)
Tryp_SPc 38..258 CDD:238113 58/270 (21%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/258 (22%)
Tryp_SPc 48..269 CDD:214473 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.