DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33461

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:303 Identity:77/303 - (25%)
Similarity:119/303 - (39%) Gaps:77/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQ---------RIIGGQAAEDGFAPYQISLQGI 58
            |.:.|.:||:.|..|:             |.::.         :||.|..|..|..|:...|   
  Fly    11 AYLALFVLGVHGSSSV-------------FLEENCGVVPRLSYKIINGTPARLGRYPWMAFL--- 59

  Fly    59 SGAHS-----CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-----------QPGGRYFL 107
               |:     |.|::||:.||||:|||:|:..  .|:...|.|..:           :....|.:
  Fly    60 ---HTPTYFLCAGSLINQWFVLTSAHCIEDDV--ELIARLGENNRDNDIDCENNRCLEATQEYNV 119

  Fly   108 KAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPI------PLPLVPMQPGDEVI---LTGWG- 162
            ..:..|..||..:..|||.:|.|...:.:....|||      .:.||.    |::.   .|||| 
  Fly   120 DMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVV----DQITWFKATGWGL 180

  Fly   163 -STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGY 226
             ||.|...|...|..|.|...|..:|..:..  ::...|.||..:..| ..|.||||||  ...|
  Fly   181 TSTDLNTKSSRVLMELNLYRRPRNDCARIFK--QNFLSGQICAGNDDG-NLCRGDSGGP--QGRY 240

  Fly   227 L----------VGLVNWGWPCATGVPDVHASVYFYRDWIRNVM 259
            :          :|:.::.:...:.| .:...|..|..||:.|:
  Fly   241 VLIFGMKRFVQMGIASFTYENCSKV-SILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/254 (26%)
Tryp_SPc 38..258 CDD:238113 69/256 (27%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 67/254 (26%)
Tryp_SPc 42..281 CDD:238113 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.