DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:116/278 - (41%) Gaps:82/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAF---------------- 85
            ||:||.||..|..|:|.||: :...|.|||::::..:|||||||...:.                
Mouse    86 RIVGGHAAPAGTWPWQASLR-LHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTVTL 149

  Fly    86 ------IPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIP 144
                  :..:::.||:     ||               .|....||||::|..|:|...:.||:.
Mouse   150 SPHFSTVKRIIMYTGS-----PG---------------PPGSSGDIALVQLSSPVALSSQVQPVC 194

  Fly   145 LP--LVPMQPGDEVILTGWGSTVLWGTS-----PIDLQVLYLQYVPHRECK--------ALLSND 194
            ||  .....||.:..:||||.|   |..     |.:||...:..|..:.|.        :|:..|
Mouse   195 LPEASADFYPGMQCWVTGWGYT---GEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPD 256

  Fly   195 EDCDVGHICTFSRLGEG-ACHGDSGGPLV----SNGYLVGLVNWGWPCATGVPD---VHASVYFY 251
            ..|         ..|.| ||..|||||||    ......|:|:||..|  |.||   |:|.|..|
Mouse   257 MLC---------ARGPGDACQDDSGGPLVCQVAGTWQQAGVVSWGEGC--GRPDRPGVYARVTAY 310

  Fly   252 RDWIRNVM--SGNSKCTG 267
            .:||.:.:  :|.|...|
Mouse   311 VNWIHHHIPEAGGSGMQG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/262 (29%)
Tryp_SPc 38..258 CDD:238113 78/264 (30%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.