DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss5

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:246 Identity:79/246 - (32%)
Similarity:108/246 - (43%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVE----NAFIPWLV--VVTGT 95
            ||:||||...|..|:|.|:. :...|:||.:::...:|:|||||:.    :....|.|  .:...
  Rat   207 RIVGGQAVASGRWPWQASVM-LGSRHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRVHAGLVSH 270

  Fly    96 NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ--PGDEVIL 158
            :...|..|....|.|. |..|.......|:|||:|..||.:.:....:.||.....  .|.:..:
  Rat   271 SAVRQHQGTMVEKIIP-HPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPAKEQHFPQGSQCWV 334

  Fly   159 TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSND---EDCDVGHICTFSRLGEG-------AC 213
            :|||.|....|...|  .|....||      |||.|   ..|......|...|..|       ||
  Rat   335 SGWGHTDPSHTHSSD--TLQDTMVP------LLSTDLCNSSCMYSGALTHRMLCAGYLDGRADAC 391

  Fly   214 HGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            .||||||||    ...:|||:|:||..|| ...|.|:|.|..:.|||.:.:
  Rat   392 QGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/240 (32%)
Tryp_SPc 38..258 CDD:238113 78/242 (32%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 78/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.