DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PRSS33

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:281 Identity:90/281 - (32%)
Similarity:127/281 - (45%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            |:||::||.:|...      :.::..|:.....||:||:...||..|:|.|:|. .|||.|||::
Human     9 VLLLLVLGAAGTQG------RKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQH-RGAHVCGGSL 66

  Fly    69 INETFVLTAAHCVENAFIPWLVVV---------TGTNKYNQPGGRYFLKAIHIHCNYDNPEMHND 124
            |...:|||||||.....:|....|         |.....:.|..|..|..     :|.......|
Human    67 IAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPP-----DYSEDGARGD 126

  Fly   125 IALLELVEPIAWDERTQPI--PLPLVPMQPGDEVILTGWGSTVLWGTSPI----DLQVLYLQYVP 183
            :|||:|..|:....|.||:  |:|.....||....:|||||  |....|:    .||.:.:..:.
Human   127 LALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGS--LRPGVPLPEWRPLQGVRVPLLD 189

  Fly   184 HRECKALLSNDEDCD-------VGHICT-FSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWP 236
            .|.|..|.....|..       .|.:|. :.:..:.||.|||||||.    .:..|||:|:||..
Human   190 SRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKG 254

  Fly   237 CA-TGVPDVHASVYFYRDWIR 256
            || ...|.|:.||..|..||:
Human   255 CALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/245 (33%)
Tryp_SPc 38..258 CDD:238113 82/247 (33%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.