DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:282 Identity:78/282 - (27%)
Similarity:124/282 - (43%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGL-SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-QGISGAHSCGG 66
            ::||:.:|. :||.     |.:|:          :|:.|:.......|:|.:| ||  ....|||
Mouse    13 ILLLLFMGAWAGLT-----RAQGS----------KILEGRECIPHSQPWQAALFQG--ERLICGG 60

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFL-------------KAIHIHC-NYD 117
            .::.:.:|||||||.:             .||:...|.:.|             ::|...| |..
Mouse    61 VLVGDRWVLTAAHCKK-------------QKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNS 112

  Fly   118 NPEMH-NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-----LQV 176
            |||.| :||.|:.|.......::.:|:.|..:..:.|.:.|::|||:.    |||.:     |..
Mouse   113 NPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTV----TSPQENFPNTLNC 173

  Fly   177 LYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGW-PCATG 240
            ..::.....:|:.....  ....|.:|..|..|...|.||||||||.:|.|.|:.:||. ||  |
Mouse   174 AEVKIYSQNKCERAYPG--KITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPC--G 234

  Fly   241 VPD---VHASVYFYRDWIRNVM 259
            .|:   |:..:..|..||:..|
Mouse   235 KPEKPGVYTKICRYTTWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/242 (28%)
Tryp_SPc 38..258 CDD:238113 70/244 (29%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.