DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK5

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:247 Identity:69/247 - (27%)
Similarity:108/247 - (43%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            |||.|...:....|:|.:|........||..:::..::||||||.:..|...|            
Human    66 RIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRL------------ 118

  Fly   102 GGRYFLKAIH-------------IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG 153
             |.|.|..::             .|..|.:|...||:.|::|...|...:..:||.:.......|
Human   119 -GHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAG 182

  Fly   154 DEVILTGWGSTVLWGTS-----PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGAC 213
            .:.:::|||:|    .|     |..||.|.:..:..:.|:.......|..:  .|...:.|..:|
Human   183 TKCLVSGWGTT----KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTM--FCAGDKAGRDSC 241

  Fly   214 HGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGNS 263
            .||||||:|.||.|.|||:|| :||| ...|.|:.::..:..||:..:..||
Human   242 QGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/237 (27%)
Tryp_SPc 38..258 CDD:238113 66/239 (28%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 1/1 (100%)
Tryp_SPc 66..285 CDD:214473 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.