DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Plau

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:254 Identity:74/254 - (29%)
Similarity:119/254 - (46%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAA----EDGFAPYQISLQGIS-GAHSCGGAIINETFVLTAAHCVENAFIP---WLVVVT 93
            :|:||:..    :..||...:..:|.| .:..|||::|:..:|.:|.||..|.  |   ..||..
  Rat   178 KIVGGEFTVVENQPWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQ--PKKEEYVVYL 240

  Fly    94 GTNKYN--QPGGRYF-LKAIHIHCNYDNPEM--HNDIALLEL---VEPIAWDERT-QPIPLPLVP 149
            |.:|.|  .||...| ::.:.:|.::.:..:  |||||||::   ....|...|| |.|.||   
  Rat   241 GQSKRNSYNPGEMKFEVEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQTICLP--- 302

  Fly   150 MQP-------GDEVILTGWGSTVLWGTS---PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT 204
              |       |.:..:||:|...  .|.   |.||::..::.:.|.:||.......:.:...:|.
  Rat   303 --PRFGDAPFGSDCEITGFGQES--ATDYFYPKDLKMSVVKIISHEQCKQPHYYGSEINYKMLCA 363

  Fly   205 FS-RLGEGACHGDSGGPLVSN----GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
            .. .....:|.|||||||:.|    ..|.|:|:||..|| ...|.|:..|.::.:||::
  Rat   364 ADPEWKTDSCSGDSGGPLICNIDGRPTLSGIVSWGSGCAEKNKPGVYTRVSYFLNWIQS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/250 (29%)
Tryp_SPc 38..258 CDD:238113 74/253 (29%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056
Connecting peptide 152..178 74/254 (29%)
Tryp_SPc 178..420 CDD:214473 72/250 (29%)
Tryp_SPc 179..423 CDD:238113 74/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.