DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klkb1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:242 Identity:84/242 - (34%)
Similarity:113/242 - (46%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCVENAFIP--W--------L 89
            ||:||..:..|..|:|:|||.  :|..|.|||:||...::||||||.:....|  |        |
  Rat   390 RIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNL 454

  Fly    90 VVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGD 154
            ..:|....::.      :|.:.||..|...|...||||::|..|:.:.|..:||.|   |.:...
  Rat   455 SEITNKTPFSS------IKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICL---PSKADT 510

  Fly   155 EVI-----LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGAC 213
            ..|     :||||.|...|.:...||...:..||:.||:... .|.......||. :...|..||
  Rat   511 NTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKY-RDYVITKQMICAGYKEGGIDAC 574

  Fly   214 HGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            .||||||||    ....|||:.:||..|| ...|.|:..|..|.|||
  Rat   575 KGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 82/240 (34%)
Tryp_SPc 38..258 CDD:238113 83/241 (34%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 82/240 (34%)
Tryp_SPc 391..621 CDD:238113 81/239 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.