DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1c2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:264 Identity:74/264 - (28%)
Similarity:109/264 - (41%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVEN------------------ 83
            ||:||...|....|:|::   :...:.|||.:|:.::|:|||||..|                  
  Rat    24 RIVGGYKCEKNSQPWQVA---VINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFA 85

  Fly    84 ------------AFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAW 136
                        .:||.:|    ||...||        :|.|        .||:.||.|.||...
  Rat    86 QRRLVRQSFRHPDYIPLIV----TNDTEQP--------VHDH--------SNDLMLLHLSEPADI 130

  Fly   137 DERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPI------DLQVLYLQYVPHRECKALLSNDE 195
            ....:.|.||....:.|...:.:||||     |:|.      |||.:.:..:.:.:|.... .|.
  Rat   131 TGGVKVIDLPTKEPKVGSTCLASGWGS-----TNPSEMVVSHDLQCVNIHLLSNEKCIETY-KDN 189

  Fly   196 DCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNV 258
            ..||.........|:..|.|||||||:.:|.|.|:.:.| .||| ...|.::|.:..:..||:.|
  Rat   190 VTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKV 254

  Fly   259 MSGN 262
            |..|
  Rat   255 MKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/255 (27%)
Tryp_SPc 38..258 CDD:238113 70/257 (27%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.