DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30323

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:259 Identity:52/259 - (20%)
Similarity:82/259 - (31%) Gaps:91/259 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAI---------------- 110
            |.|.|::::..:|:|:..||.         ....:..|||..|..|:.:                
  Fly    52 HFCAGSLLSAWWVVTSGCCVS---------TRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIY 107

  Fly   111 HIH-----------CNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILT----- 159
            |:.           |        .::|||:|...:....        ...|.|..|:..|     
  Fly   108 HVQKIVLDESAISGC--------TELALLKLDRGVTGQR--------FAMMLPEKELNSTWLCNS 156

  Fly   160 -GWG----------------------STVLW---GTSPIDLQVLYLQYVPHRECKALLSNDEDCD 198
             |||                      :.|.|   |....:|..:..|.:...|||      .||.
  Fly   157 LGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECK------PDCS 215

  Fly   199 VGHICTFSRLGEG-ACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSG 261
             ..:|..|..|.| .|..|.|.||..:.:|.|:......|.......:.::|..|.:|.:.:||
  Fly   216 -RCLCMTSYTGRGNMCQQDLGSPLFCDHFLYGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLSG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 49/251 (20%)
Tryp_SPc 38..258 CDD:238113 50/254 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 50/254 (20%)
Tryp_SPc 45..272 CDD:214473 49/251 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.