DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30187

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:111/263 - (42%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FYKDQRIIGGQAAEDGFAPYQISLQGISGAHS-------------------CGGAIINETFVLTA 77
            |.||   :|.....|......|:|: |:|.|:                   |||.:|::.|||||
  Fly    14 FLKD---VGASIFLDQICGINIALK-ITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTA 74

  Fly    78 AHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYD-NPEMHNDIALLELVEPIAWDERTQ 141
            |||:.:..:.  .|..|....:.|..|..:....:|.::| .....|||.||:|...:.::...:
  Fly    75 AHCIVDQDVQ--SVSLGAYNKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIR 137

  Fly   142 PIPLPLVP-----MQPGDEVILTGWGSTVLWGTSPID-LQVLYLQYVPHRECKALLS---NDEDC 197
            ||.:.|..     |:........|||:  |.|....| ||.:.|.::...||...||   :::  
  Fly   138 PICIVLNKSMANHMRNMRTFKAFGWGT--LRGNKTSDILQTIILNHLDREECYMELSVYPSEK-- 198

  Fly   198 DVGHICTFSRLGEGACHGDSGGPLVSNGYL---------VGLVNWGWPCATGVPDVHASVYFYRD 253
               .||.....|: .|.|||||||.::.::         .|:::.|.....| ..|:..:..:.|
  Fly   199 ---QICAGVPSGD-TCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDG-QGVYTDLMSFAD 258

  Fly   254 WIR 256
            ||:
  Fly   259 WIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/255 (25%)
Tryp_SPc 38..258 CDD:238113 66/257 (26%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 60/236 (25%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.