DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30091

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:254 Identity:67/254 - (26%)
Similarity:118/254 - (46%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV---ENAFIPW--LVVVTG-- 94
            :|:||..|.:...|: ::|...:....|||::|...||||||||:   |...:.:  |.|..|  
  Fly    36 KIVGGVDAGELKNPW-MALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVY 99

  Fly    95 ----TNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL-VPMQPGD 154
                |.::|.|...|.::.::||.::......||||||.|.:.|.:..:.:|:.:.| ..::|..
  Fly   100 HLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQT 164

  Fly   155 EVI----LTGWGSTVLWGTSPI--DLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGAC 213
            ::|    ..|||.|   |...:  :||::.:..:..:.|:|......|..:  .|..:.:|...|
  Fly   165 DLIQEFTAIGWGVT---GNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPM--FCAGTAVGRDTC 224

  Fly   214 HGDSGGPL--------VSNGYLVGLVNWGWPCATGVPD-----VHASVYFYRDWIRNVM 259
            ..||||||        :.....:|:|      :||..|     ::..|..:.|:|..::
  Fly   225 KRDSGGPLYIHMLFDGIKRATQLGIV------STGTEDCRGFGMYTDVMGHIDFIERIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/248 (27%)
Tryp_SPc 38..258 CDD:238113 67/250 (27%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 66/248 (27%)
Tryp_SPc 37..276 CDD:238113 67/250 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.