DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30087

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:282 Identity:87/282 - (30%)
Similarity:124/282 - (43%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNSTDGRF--------YKDQ---RIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            :::|..|| :....|.:|        |:.|   |::.|:.|....||:.:.:...|..| |||:|
  Fly     9 VIAICLIR-QQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTH-CGGSI 71

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKYN----------QPGGRYF--LKAIHIHCNYDNPEM 121
            :|..::|||||||    .|.|.:..|.:...          .|....:  :||| .|..|:....
  Fly    72 LNSRYILTAAHCV----FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAI-THRFYNAANH 131

  Fly   122 HNDIALLELVEPIAWDERTQPIPLPLVPMQ-PGDEVILT-GWGSTVLWGTSPIDLQVLYLQYVPH 184
            .||||||:|...|.::...|||.:.|.|.. |......| |||.|...| .|..||...|:....
  Fly   132 VNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDA 195

  Fly   185 RECK----ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS-------NGYL-VGLVNWGWPC 237
            ..|.    |.::.::.| .||      .....|.||||||||:       ..|| :|:|::| |.
  Fly   196 AYCSRSFHAYMNGNQIC-AGH------EERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYG-PT 252

  Fly   238 ATGVPDVHASVYFYRDWIRNVM 259
            ....|.|:..|..|.:|||..|
  Fly   253 DCQSPGVYTYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/243 (31%)
Tryp_SPc 38..258 CDD:238113 78/245 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 76/243 (31%)
Tryp_SPc 42..272 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.