DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG30025

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:255 Identity:85/255 - (33%)
Similarity:133/255 - (52%) Gaps:22/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNSTDGRFYK-DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAA 78
            |:|..|..:.|...:|...: |.||:||.|......|:|||||. ||:|||||:|.:...::|||
  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSSNVIVTAA 70

  Fly    79 HCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPI 143
            ||:::.....|.:..|::.::..|..:.:.:...|..|:...|.||||::::...:.:....:.|
  Fly    71 HCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI 135

  Fly   144 PLPLVPMQPGDEVILTGWGSTVLWGTS--PIDLQVLYLQYVPHRECKALLSNDEDCDVGH----- 201
            .|.......|....::||| |:.:|:|  |..||.:.:..|...:|.:       ...|:     
  Fly   136 GLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCAS-------STYGYGSQIR 192

  Fly   202 ---ICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
               ||. :..|:.||.|||||||||.|.|||:|:||:.|| :..|.|:|.|...|.|:.|
  Fly   193 STMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/228 (34%)
Tryp_SPc 38..258 CDD:238113 78/231 (34%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 77/228 (34%)
Tryp_SPc 31..252 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.