DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Cela2a

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:113/261 - (43%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGA---HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY 98
            |::|||.|.....|:|:|||.:|..   |:|||:::...:|||||||:.|           :..|
  Rat    30 RVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGGSLVANNWVLTAAHCISN-----------SRTY 83

  Fly    99 NQPGGRYFLK--------------AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP 149
            ....||:.|.              .:|...|.......|||||::|..|:|...:.|...||   
  Rat    84 RVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQKLSNGNDIALVKLASPVALTSKIQTACLP--- 145

  Fly   150 MQPGDEVI-------LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSR 207
              |...::       :||||.....|.:|..||...|..|.:..|.:............:|..  
  Rat   146 --PAGTILPNNYPCYVTGWGRLQTNGATPDVLQQGRLLVVDYATCSSASWWGSSVKTNMVCAG-- 206

  Fly   208 LGEG---ACHGDSGGPL---VSNG--YLVGLVNWGWPCATGV---PDVHASVYFYRDWIRNVMSG 261
             |:|   :|:|||||||   .|||  .:.|:|::|.......   |.|...|..|.|||.:|::.
  Rat   207 -GDGVTSSCNGDSGGPLNCQASNGQWQVHGIVSFGSTLGCNYPRKPSVFTRVSNYIDWINSVIAK 270

  Fly   262 N 262
            |
  Rat   271 N 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/252 (29%)
Tryp_SPc 38..258 CDD:238113 75/254 (30%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 74/252 (29%)
Tryp_SPc 31..267 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.