DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:276 Identity:81/276 - (29%)
Similarity:123/276 - (44%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :|.:.:|:.|.|              .|.|   :.:|||.|...::|..|:|::|...:..| ||
Mouse     6 LSLITVLLSLAL--------------ETAG---QGERIIDGYKCKEGSHPWQVALLKGNQLH-CG 52

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI--HCNYDNPEMHNDIALL 128
            |.::::.:|||||||....:    .|..|::|......:. :||...  |..|......|||.|:
Mouse    53 GVLVDKYWVLTAAHCKMGQY----QVQLGSDKIGDQSAQK-IKATKSFRHPGYSTKTHVNDIMLV 112

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWG-TSPIDLQVLYLQYVPHRECKALLS 192
            .|.||:....:.:.:.||.....||....::|||:|.... |.|.||....::.:..||||.:..
Mouse   113 RLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYK 177

  Fly   193 NDEDCDVGHICTFSRLGE------------GACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPD 243
            :             .||:            ..|:||||||||.|..|.|||:|| :||. ...|.
Mouse   178 D-------------LLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPG 229

  Fly   244 VHASVYFYRDWIRNVM 259
            |:..|..|:.|:...|
Mouse   230 VYTQVCKYKRWVMETM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/234 (31%)
Tryp_SPc 38..258 CDD:238113 73/236 (31%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 73/234 (31%)
Serine protease. /evidence=ECO:0000250 26..246 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.