DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss58

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:224 Identity:58/224 - (25%)
Similarity:93/224 - (41%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGR-----YFLKA 109
            ||.:.|:  |....|.|.:|:..:|:|||||    .:|.|.|:.|......|..|     .:.|.
Mouse    29 PYLVYLK--SDYLPCTGVLIHPLWVITAAHC----NLPNLQVILGITNPADPMERDVEVSDYEKI 87

  Fly   110 IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGT-SPID 173
            .| |.|:....:.:|:.|::|...|......:.:.||...:.......::.|...:...| .|..
Mouse    88 FH-HPNFLVSSISHDLLLIKLKRRIKHSNYAKAVKLPQHIVSVNAMCSVSTWAYNLCDVTKDPDS 151

  Fly   174 LQVLYLQYVPHREC----KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG 234
            ||.:.:..:...||    ||....:....|| |....||   .|...:..|.|.||.|.|::::.
Mouse   152 LQTVNVTVISKAECRNAYKAFDITENMICVG-IVPGRRL---PCKEVTAAPAVCNGVLYGILSYA 212

  Fly   235 WPCATGVP-DVHASVYFYRDWIRNVMSGN 262
            ..|..... .::||::.|..||.:.|..|
Mouse   213 DGCVLRADVGIYASIFHYLPWIEDTMKNN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 54/215 (25%)
Tryp_SPc 38..258 CDD:238113 56/218 (26%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 56/218 (26%)
Tryp_SPc 29..234 CDD:214473 54/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.