DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and PRSS54

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:285 Identity:74/285 - (25%)
Similarity:117/285 - (41%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFA-----PYQISLQGISGAHSC 64
            |||:||||  |.|.|:..::..|.   ||       |...::|..     |:.:|||.....|..
Human    16 VLLVLLGL--LYSSTSCGVQKASV---FY-------GPDPKEGLVSSMEFPWVVSLQDSQYTHLA 68

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPG----GRYFLKAIHIHCNYDNPEMHNDI 125
            .|.|::|.:||:.|..::|.  ..:||:.|.:..: |.    ..|.:..|.||.::||..|.|:|
Human    69 FGCILSEFWVLSIASAIQNR--KDIVVIVGISNMD-PSKIAHTEYPVNTIIIHEDFDNNSMSNNI 130

  Fly   126 ALLE---------LVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWG---TSPI------ 172
            |||:         ||:.|.:..|....| |::     ....::||..|...|   |..:      
Human   131 ALLKTDTAMHFGNLVQSICFLGRMLHTP-PVL-----QNCWVSGWNPTSATGNHMTMSVLRKIFV 189

  Fly   173 -DLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN------GYLVGL 230
             ||.:..|..:...||.:....:.              :.||.||.|.|::..      ..|.|:
Human   190 KDLDMCPLYKLQKTECGSHTKEET--------------KTACLGDPGSPMMCQLQQFDLWVLRGV 240

  Fly   231 VNWGWPCATGVPDVHASVYFYRDWI 255
            :|:|.....|: .::..|..|..||
Human   241 LNFGGETCPGL-FLYTKVEDYSKWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/251 (24%)
Tryp_SPc 38..258 CDD:238113 61/252 (24%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 57/235 (24%)
Tryp_SPc 52..264 CDD:238113 57/235 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.