DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss38

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:281 Identity:81/281 - (28%)
Similarity:132/281 - (46%) Gaps:39/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAI-----RIKGNSTDGRFYKDQ-----RIIGGQAAEDGFAPYQISLQGISG 60
            ||..|.|:....:|::     :.:.||..|.....|     :::||:.|.|...|:|:||. .||
Mouse    14 LLFPLLLASPTWVTSVSRRHPKSQANSLSGDVACGQPVLQGKLLGGEFARDRKWPWQVSLH-YSG 77

  Fly    61 AHSCGGAIINETFVLTAAHCVENA----FIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEM 121
            .|.|||:|::..:||:||||.:..    .....|.:|...|.|:....:.:..:.||..:   :|
Mouse    78 FHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEKANRHTQWFEIYQVIIHPTF---QM 139

  Fly   122 HN----DIALLELVEPIAWDERTQPIPLPLVPMQPGDEVIL------TGWGSTVLWGTSPIDLQV 176
            ::    |:||::|...|.:.:...||.||     |.|..::      ||||.....|.:..:|..
Mouse   140 YHPIGGDVALVQLKSAIVFSDFVLPICLP-----PSDLYLINLSCWTTGWGMISPQGETGNELLE 199

  Fly   177 LYLQYVPHRECKALLSNDEDCDVGHICTFS-RLGEGACHGDSGGPLV---SNGYL-VGLVNWGWP 236
            ..|..:|..:|:.|...........:|... :..:..|.||||.|||   :..:| :|:|:||..
Mouse   200 AQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRG 264

  Fly   237 CATGV-PDVHASVYFYRDWIR 256
            ||..: |.|.|:|.::..|||
Mouse   265 CAQPLYPGVFANVSYFLSWIR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/237 (29%)
Tryp_SPc 38..258 CDD:238113 72/239 (30%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 72/237 (30%)
Tryp_SPc 58..284 CDD:214473 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.