DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and F10

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:243 Identity:79/243 - (32%)
Similarity:113/243 - (46%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||:|||..:||..|:|..|........|||.|::|.::||||||:..| ..:.|.|...|...:.
Human   234 RIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQA-KRFKVRVGDRNTEQEE 297

  Fly   102 GGRYFLKAIH-----IHCNYDNPEMHN-DIALLELVEPIAWDERTQPIPLP--------LVPMQP 152
            ||    :|:|     |..|....|.:: |||:|.|..||.:.....|..||        |:..:.
Human   298 GG----EAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKT 358

  Fly   153 GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGD 216
            |   |::|:|.|...|.....|::|.:.||....||  ||:.........|. :....|.||.||
Human   359 G---IVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCK--LSSSFIITQNMFCAGYDTKQEDACQGD 418

  Fly   217 SGGPLVS----NGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            ||||.|:    ..::.|:|:||..|| .|...::..|..:..||...|
Human   419 SGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSM 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/237 (32%)
Tryp_SPc 38..258 CDD:238113 77/239 (32%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 77/238 (32%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.