DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and F9

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:265 Identity:81/265 - (30%)
Similarity:122/265 - (46%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NSTDGRFYKDQ------------RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAA 78
            |||:.....|.            |::||:.|:.|..|:|:.|.|...|. |||:|:||.:::|||
Human   203 NSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAF-CGGSIVNEKWIVTAA 266

  Fly    79 HCVENAFIPWLVVVTGTNKYNQ----PGGRYFLKAIHIHCNYDNP--EMHNDIALLELVEPIAWD 137
            ||||...  .:.||.|.:...:    ...|..::.|. |.||:..  :.::|||||||.||:..:
Human   267 HCVETGV--KITVVAGEHNIEETEHTEQKRNVIRIIP-HHNYNAAINKYNHDIALLELDEPLVLN 328

  Fly   138 ERTQPIPLP-------LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC----KALL 191
            ....||.:.       .:....|   .::|||.....|.|.:.||.|.:..|....|    |..:
Human   329 SYVTPICIADKEYTNIFLKFGSG---YVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTI 390

  Fly   192 SNDEDCDVGHICTFSRLGEGACHGDSGGPLVS----NGYLVGLVNWGWPCA-TGVPDVHASVYFY 251
            .|:..|     ..|...|..:|.||||||.|:    ..:|.|:::||..|| .|...::..|..|
Human   391 YNNMFC-----AGFHEGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRY 450

  Fly   252 RDWIR 256
            .:||:
Human   451 VNWIK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/239 (31%)
Tryp_SPc 38..258 CDD:238113 76/241 (32%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 76/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.