DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and F2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_000497.1 Gene:F2 / 2147 HGNCID:3535 Length:622 Species:Homo sapiens


Alignment Length:272 Identity:84/272 - (30%)
Similarity:127/272 - (46%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINETFVLTAAHCVENAFIPW-------- 88
            |.|.||:.|..||.|.:|:|:.|...|... .||.::|::.:|||||||:  .:.||        
Human   359 YIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCL--LYPPWDKNFTEND 421

  Fly    89 LVVVTGTNKYNQPGGRY--------FLKAIHIHCNYD-NPEMHNDIALLELVEPIAWDERTQPIP 144
            |:|..|  |:::.  ||        .|:.|:||..|: ...:..||||::|.:|:|:.:...|:.
Human   422 LLVRIG--KHSRT--RYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVC 482

  Fly   145 LP-----LVPMQPGDEVILTGWGS-TVLWGTS-----PIDLQVLYLQYVPHRECK-----ALLSN 193
            ||     ...:|.|.:..:||||: ...|..:     |..|||:.|..|....||     .:..|
Human   483 LPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDN 547

  Fly   194 DEDCDVGHICTFSRLGEG----ACHGDSGGPLV------SNGYLVGLVNWGWPC-ATGVPDVHAS 247
                   ..|...:..||    ||.||||||.|      :..|.:|:|:||..| ..|....:..
Human   548 -------MFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTH 605

  Fly   248 VYFYRDWIRNVM 259
            |:..:.||:.|:
Human   606 VFRLKKWIQKVI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/262 (30%)
Tryp_SPc 38..258 CDD:238113 80/264 (30%)
F2NP_000497.1 GLA 25..88 CDD:214503
KR 105..186 CDD:238056
KR 211..293 CDD:214527
Thrombin_light 317..363 CDD:286482 2/3 (67%)
Tryp_SPc 363..613 CDD:214473 79/262 (30%)
Tryp_SPc 364..616 CDD:238113 80/264 (30%)
High affinity receptor-binding region which is also known as the TP508 peptide 551..573 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.