DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:269 Identity:87/269 - (32%)
Similarity:120/269 - (44%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSG-LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVL 75
            ||| |||:..:..      |:..|..|::||..|.....|:|:|:| .:..|.|||:|::..::|
Mouse   182 LSGSLVSLRCLDC------GKSLKTPRVVGGVEAPVDSWPWQVSIQ-YNKQHVCGGSILDPHWIL 239

  Fly    76 TAAHCVENAF--IPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNP--EMHNDIALLELVEPIAW 136
            |||||.....  ..|.|........|.|.    |....|.....||  ....||||::|..|:.:
Mouse   240 TAAHCFRKYLDVSSWKVRAGSNILGNSPS----LPVAKIFIAEPNPLYPKEKDIALVKLQMPLTF 300

  Fly   137 DERTQPIPLP-----LVPMQPGDEVILTGWGSTVLWGTSPIDLQV-LYLQYVPHRECKALLSNDE 195
            ....:||.||     |||..|   |.:.|||.|...|....|:.: ..:|.:....|     |.|
Mouse   301 SGSVRPICLPFSDEVLVPATP---VWVIGWGFTEENGGKMSDMLLQASVQVIDSTRC-----NAE 357

  Fly   196 DCDVGHICTFSRL-------GEGACHGDSGGPLVSNG---YLVGLVNWGWPC-ATGVPDVHASVY 249
            |...|.: |...|       |:..|.|||||||:.:.   .:||:|:||..| ....|.|:..|.
Mouse   358 DAYEGEV-TAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVT 421

  Fly   250 FYRDWIRNV 258
            .|.:||.||
Mouse   422 AYLNWIYNV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/238 (32%)
Tryp_SPc 38..258 CDD:238113 76/240 (32%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 6/18 (33%)
Tryp_SPc 202..427 CDD:214473 75/238 (32%)
Tryp_SPc 203..430 CDD:238113 76/240 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.