DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_766043.3 Gene:Tmprss7 / 208171 MGIID:2686594 Length:829 Species:Mus musculus


Alignment Length:254 Identity:78/254 - (30%)
Similarity:114/254 - (44%) Gaps:58/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFI----PWL----VVVT 93
            ||:||..:::|..|:|:||..:..|: ||.::|:..::|:||||.....:    ||.    :.|.
Mouse   591 RIVGGSDSQEGTWPWQVSLHFVGSAY-CGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQ 654

  Fly    94 GTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDER----TQPIPLPLV--PMQP 152
            |..|:..|     ::.|.:|..|::.....|||||:|  .|||.|.    .|||.:|..  .::.
Mouse   655 GNAKFISP-----VRRIVVHEYYNSQTFDYDIALLQL--SIAWPETLKQLIQPICIPPAGQKVRS 712

  Fly   153 GDEVILTGW---------GSTVLWGTSP--IDLQVLYLQY---VPHRECKALLSNDEDCDVGHIC 203
            |::..:|||         ||.||.....  ||..|....|   .....|..::|...|       
Mouse   713 GEKCWVTGWGRRHEADSKGSPVLQQAEVELIDQTVCVSTYGIITSRMLCAGVMSGKSD------- 770

  Fly   204 TFSRLGEGACHGDSGGPL----VSNG--YLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
                    ||.|||||||    .|:|  .|.|:|:||..|. ...|.|:..|..:..||
Mouse   771 --------ACKGDSGGPLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSSFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/252 (30%)
Tryp_SPc 38..258 CDD:238113 77/253 (30%)
Tmprss7NP_766043.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
SEA 94..194 CDD:366610
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060
Tryp_SPc 591..821 CDD:214473 76/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.