DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and ELANE

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:279 Identity:82/279 - (29%)
Similarity:124/279 - (44%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            ::.|:..:|||.:.|.|                   .|:||:.|.....|:.:||| :.|.|.||
Human    12 LACVLPALLLGGTALAS-------------------EIVGGRRARPHAWPFMVSLQ-LRGGHFCG 56

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN--QPGGRYFLKAIHIHCNYDNPEMHNDIALL 128
            ..:|...||::|||||.|..:..:.||.|.:..:  :|..:.|.........||...:.|||.:|
Human    57 ATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVIL 121

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDEV--ILTGWGSTVLWGTS---PIDLQVLYLQYVPHRECK 188
            :|......:...|...||....:.|:.|  :..|||   |.|.:   ...||.|.:..|...   
Human   122 QLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWG---LLGRNRGIASVLQELNVTVVTSL--- 180

  Fly   189 ALLSNDEDCDVGHICTFSRLGE-GACHGDSGGPLVSNGYLVGL---VNWGWPCATGV-PDVHASV 248
                    |...::||..|..: |.|.||||.|||.||.:.|:   |..|  ||:|: ||..|.|
Human   181 --------CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGG--CASGLYPDAFAPV 235

  Fly   249 YFYRDWIRNVM--SGNSKC 265
            ..:.:||.:::  |.::.|
Human   236 AQFVNWIDSIIQRSEDNPC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/229 (31%)
Tryp_SPc 38..258 CDD:238113 74/231 (32%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.