DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CELA1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001962.3 Gene:CELA1 / 1990 HGNCID:3308 Length:258 Species:Homo sapiens


Alignment Length:267 Identity:85/267 - (31%)
Similarity:118/267 - (44%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGA---HSCGGAIINETFVLTAAHCVENAFI 86
            |:||......:.|::||..|.....|.|||||..||.   |:|||.:|.:.:|:||||||:  :.
Human     6 GHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVD--YQ 68

  Fly    87 PWLVVVTGTNKYNQPGG--RYFLK---AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP 146
            ....||.|.:..:|..|  :|...   .:|.:.|.||.....|||||.|.:.:..:...|   |.
Human    69 KTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQ---LG 130

  Fly   147 LVPMQ-----PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK------ALLSNDEDCDVG 200
            ::|.:     ......:||||.|...|.....||..||..|.:..|.      :.:.|...| .|
Human   131 VLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVC-AG 194

  Fly   201 HICTFSRLGEG---ACHGDSGGP---LVSNGYLV-GLVNWGWPCATGV---PDVHASVYFYRDWI 255
                    |:|   .|.||||||   ||:..|.| |:.::.......|   |.|...|..|..||
Human   195 --------GDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWI 251

  Fly   256 RNVMSGN 262
            .||::.|
Human   252 NNVIASN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/246 (31%)
Tryp_SPc 38..258 CDD:238113 78/248 (31%)
CELA1NP_001962.3 Tryp_SPc 19..254 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.