DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:290 Identity:85/290 - (29%)
Similarity:131/290 - (45%) Gaps:51/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTD---GRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62
            :.|:.:|:|:||  |.|    ||..:.|:   |...: .||.||.:|:.|..|:|:|:. .:|.|
  Rat    12 LEALFILLLIGL--LQS----RIGADGTEASCGAVIQ-PRITGGGSAKPGQWPWQVSIT-YNGVH 68

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKA------IHI------HCN 115
            .|||::::..:|::||||.....        ...:|....|.:.|.:      :|.      |.:
  Rat    69 VCGGSLVSNQWVVSAAHCFPREH--------SKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSS 125

  Fly   116 YDNPEMHNDIALLELVEPIAWDERTQPIPLPL--VPMQPGDEVILTGWG----STVLWGTSPIDL 174
            |.......||||:.|..|:.:....:||.||.  .....|....:||||    |..|  .:|..|
  Rat   126 YREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSL--QTPRPL 188

  Fly   175 QVLYLQYVPHRECKALLSNDEDCDVGH------ICT-FSRLGEGACHGDSGGPLVS--NG--YLV 228
            |.|.:..:....|..|.:.:...:..|      :|. :.:.|:.||.|||||||..  :|  ||.
  Rat   189 QQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLA 253

  Fly   229 GLVNWGWPC-ATGVPDVHASVYFYRDWIRN 257
            |:|:||..| |...|.|:.....|..||.:
  Rat   254 GIVSWGDACGAPNRPGVYTLTSTYASWIHH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/247 (29%)
Tryp_SPc 38..258 CDD:238113 73/250 (29%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 72/247 (29%)
Tryp_SPc 45..284 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.