DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prtn3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:267 Identity:84/267 - (31%)
Similarity:120/267 - (44%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ--GISGAHSCGGAI 68
            ||:.|.:.|.|..:                 :|:||..|.....||..|||  ...|:|.|||.:
Mouse    15 LLLALVVGGAVQAS-----------------KIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTL 62

  Fly    69 INETFVLTAAHCVENAFIPW--LVVVTGTNKY--NQPGGRYFLKAIHIHCNYDNPEMHNDIALLE 129
            |:..||||||||:::  |.|  :.||.|.:..  ::|..:.|..:.....||:..|..||:.||:
Mouse    63 IHPRFVLTAAHCLQD--ISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQ 125

  Fly   130 LVEPIAWDERTQPIPLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLS 192
            |....:..:......||.  ..:..|.:.:..|||.......:|..||.|.:..|...       
Mouse   126 LNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTFL------- 183

  Fly   193 NDEDCDVGHICTF-SRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCAT-GVPDVHASVYFYRDW 254
                |...::||. .|...|.|.|||||||:.||.|.|:.::. ..||: ..||..|.|..|.||
Mouse   184 ----CREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDW 244

  Fly   255 IRNVMSG 261
            |:||:.|
Mouse   245 IQNVLRG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/228 (32%)
Tryp_SPc 38..258 CDD:238113 76/230 (33%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 74/228 (32%)
Tryp_SPc 30..248 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.