DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Proc

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:258 Identity:82/258 - (31%)
Similarity:113/258 - (43%) Gaps:55/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            |.||:.|...:.|.:|:|..|.......:|||.:|:.::|||||||||           ||.|..
Mouse   233 DPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVE-----------GTKKLT 286

  Fly   100 QPGGRYFL------------KAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPM-- 150
            ...|.|.|            |.|.:|.||......||||||.|.:|....:...||.||...:  
Mouse   287 VRLGEYDLRRRDHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQ 351

  Fly   151 ---QPGDEVILTGWGSTVLWGTSPID---------LQVLYLQYVPHRECKALLSN--DEDCDVGH 201
               |.|.|.::||||    :.:..|.         |..:.:..|...||..::.|  .|:.    
Mouse   352 ELTQAGQETVVTGWG----YQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVVSENM---- 408

  Fly   202 ICTFSRLGE--GACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
            :|. ..:|:  .||.||||||:|    ...:|||||:||..|. |....::..|..|..||.:
Mouse   409 LCA-GIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWIHS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/252 (31%)
Tryp_SPc 38..258 CDD:238113 80/255 (31%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209
Tryp_SPc 236..470 CDD:238113 80/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.