DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Plg

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032903.3 Gene:Plg / 18815 MGIID:97620 Length:812 Species:Mus musculus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:116/252 - (46%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQ-GISGAHSCGGAIINETFVLTAAHCVENAFIP-WLVVVTGTNKYN 99
            |::||..|.....|:||||: ..:|.|.|||.:|...:|||||||:|.:..| :..|:.|.::  
Mouse   581 RVVGGCVANPHSWPWQISLRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHE-- 643

  Fly   100 QPGGRYFLKAIHIHCNYDNPEM----------HNDIALLELVEPIAWDERTQPIPLPLVPMQPGD 154
                 .:::.:      |..|:          :.|||||:|..|....::..|..||.......|
Mouse   644 -----EYIRGL------DVQEISVAKLILEPNNRDIALLKLSRPATITDKVIPACLPSPNYMVAD 697

  Fly   155 EVI--LTGWGSTVLWGTSPID-LQVLYLQYVPHRECKAL------LSNDEDCDVGHICTFSRLGE 210
            ..|  :||||.|  .||.... |:...|..:.::.|..:      :.:.|.| .|.:..    |.
Mouse   698 RTICYITGWGET--QGTFGAGRLKEAQLPVIENKVCNRVEYLNNRVKSTELC-AGQLAG----GV 755

  Fly   211 GACHGDSGGPLV---SNGYLV-GLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            .:|.||||||||   .:.|:: |:.:||..|| ...|.|:..|..:.|||...|..|
Mouse   756 DSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIEREMRNN 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/243 (30%)
Tryp_SPc 38..258 CDD:238113 74/245 (30%)
PlgNP_032903.3 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
KR 183..262 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
KR 480..562 CDD:214527
Tryp_SPc 581..805 CDD:214473 73/243 (30%)
Tryp_SPc 582..807 CDD:238113 74/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.