DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and try-6

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:286 Identity:51/286 - (17%)
Similarity:90/286 - (31%) Gaps:89/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTD-GRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS- 63
            :.::|.:.|:.......:||...:....| |:..| .:|..|:.||...||:.:.:...:...: 
 Worm     4 LQSIVTICLIVFVDSRKLTAEENEKRLEDCGKNVK-SKIFNGRKAEIDEAPWAVRINTYTNVKNI 67

  Fly    64 -------CGGAIINETFVLTAAHCVEN-AFIPW----------------------------LVVV 92
                   |.|.:.:...:|||.||... ....|                            .:||
 Worm    68 DETWSKHCSGTLTSPRHILTATHCAATYTETEWNGTVIDAPIYRKYCEEQSTLIVREVAASRIVV 132

  Fly    93 TGTNKYNQPGGRYFLKAIHIHC------NYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVP 149
            ...|:......:|..  :..:|      |....:..:||.::||.|.:.:....:|:.:.  ...
 Worm   133 RLRNRTEIGRAKYLF--MFNYCRKIVDKNAYEIQYPDDIMIIELSEDVEYSSELKPVCVAGNTDD 195

  Fly   150 MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH----ICTFSRLGE 210
            ..|...:.|.|:|..                  |.|:..:.|.|..|..:.|    |...::.|.
 Worm   196 NAPNSHLDLFGFGDD------------------PPRDKPSSLKNLHDIPLKHHKVEIMDMNKEGT 242

  Fly   211 G------------------ACHGDSG 218
            .                  ||.||||
 Worm   243 SKRMDPRLFIAKSVTRTSVACPGDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 44/249 (18%)
Tryp_SPc 38..258 CDD:238113 44/248 (18%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 51/283 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.