Sequence 1: | NP_001097818.1 | Gene: | CG31269 / 318653 | FlyBaseID: | FBgn0051269 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001361988.1 | Gene: | try-6 / 185959 | WormBaseID: | WBGene00006624 | Length: | 343 | Species: | Caenorhabditis elegans |
Alignment Length: | 286 | Identity: | 51/286 - (17%) |
---|---|---|---|
Similarity: | 90/286 - (31%) | Gaps: | 89/286 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSAVVLLILLGLSGLVSITAIRIKGNSTD-GRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS- 63
Fly 64 -------CGGAIINETFVLTAAHCVEN-AFIPW----------------------------LVVV 92
Fly 93 TGTNKYNQPGGRYFLKAIHIHC------NYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVP 149
Fly 150 MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH----ICTFSRLGE 210
Fly 211 G------------------ACHGDSG 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31269 | NP_001097818.1 | Tryp_SPc | 37..255 | CDD:214473 | 44/249 (18%) |
Tryp_SPc | 38..258 | CDD:238113 | 44/248 (18%) | ||
try-6 | NP_001361988.1 | DUF316 | 7..320 | CDD:367641 | 51/283 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |