DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and try-4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:251 Identity:57/251 - (22%)
Similarity:93/251 - (37%) Gaps:81/251 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT------NK-YNQPGGRY-- 105
            |:.:|.. :.|.:..||:||:...::||||        ..:...|:      || :.:|....  
 Worm    59 PWAVSFT-VDGVNRLGGSIISPYHIITAAH--------GFITTIGSRGNLCENKNWKKPNSSIYR 114

  Fly   106 ---FLK----------AIHIHCN-YDNPE-------MHN--------------------DIALLE 129
               ||:          .|..|.: |.|..       :||                    |.|::|
 Worm   115 SIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVE 179

  Fly   130 LVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-PIDLQVLYLQYVP---HRECKAL 190
            :.:.|.:.|..:||.||...|.....:.:.|||.:.::..| |:      :..:|   .|:||..
 Worm   180 VEKRIHFSENVRPICLPRPNMYYTKSLAVPGWGRSYIFNESGPL------IHEIPMRIDRDCKRP 238

  Fly   191 LSNDEDCDV-GHICTFSR-----LGEGACHGDSGGPL------VSNGYLVGLVNWG 234
            .|:....|. ..||..|.     .....|||||||.|      ....:|:.:.::|
 Worm   239 WSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/251 (23%)
Tryp_SPc 38..258 CDD:238113 57/251 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 57/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.