DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and svh-1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:266 Identity:78/266 - (29%)
Similarity:125/266 - (46%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG-ISGAHSCGGAIINETFVLTAAHCV-ENAF 85
            ::.|:.|....:..|::||.....|..|:..:|:. .:.||.||.:|:::|.::|||||. |:..
 Worm   698 VEVNARDAAKSRIARVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCFEEDER 762

  Fly    86 IPWLVVVTGTNKYNQPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEP-IAWDERTQPIPLP 146
            :....||.|....||..|.   ::|:.||.:..|.:...| |||:||:..| |.::|..|||.||
 Worm   763 VSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSH-DIAILEIPYPGIEFNEYAQPICLP 826

  Fly   147 LVPM--QPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL-LSNDEDCDVGHICTFSRL 208
            ....  .||.:.:::||||             :.|:|....:...: :.|..|| |.....:|.:
 Worm   827 SKDFVYTPGRQCVVSGWGS-------------MGLRYAERLQAALIPIINRFDC-VNSSQIYSSM 877

  Fly   209 GEGA------------CHGDSGGPLV---SNG--YLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            ...|            |.||||||..   .:|  .|.|:::||..|| ...|.::..|..|..||
 Worm   878 SRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWI 942

  Fly   256 RNVMSG 261
            ..:::|
 Worm   943 SAIING 948

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/244 (30%)
Tryp_SPc 38..258 CDD:238113 74/246 (30%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 74/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.