DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Gzmm

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus


Alignment Length:292 Identity:88/292 - (30%)
Similarity:125/292 - (42%) Gaps:81/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIIN 70
            ||:||.|..|.:      .||    ||  :.:||||:.|.....||..|||. :.:|.|||.:::
Mouse     7 LLLLLALKTLWA------AGN----RF--ETQIIGGREAVPHSRPYMASLQK-AKSHVCGGVLVH 58

  Fly    71 ETFVLTAAHCVENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVE 132
            ..:|||||||:... :..|.:|.|.:..:   .||..::::....|..| |.:..||:|||:|  
Mouse    59 RKWVLTAAHCLSEP-LQNLKLVLGLHNLHDLQDPGLTFYIREAIKHPGY-NHKYENDLALLKL-- 119

  Fly   133 PIAWDERTQPI----PLPLVPMQPGDEVILTGWGSTVLWGTS-----------PIDLQVLYLQYV 182
                |.|.||.    ||.| |.:|..:.....|.||..||.:           .:||:||..|  
Mouse   120 ----DRRVQPSKNVKPLAL-PRKPRSKPAEGTWCSTAGWGMTHQGGPRARALQELDLRVLDTQ-- 177

  Fly   183 PHRECKALLSNDEDCDVGHICTFSRLGEGA-----------------CHGDSGGPLV-SNGYLVG 229
                               :|..||...|.                 |.|||||||| ..|.:.|
Mouse   178 -------------------MCNNSRFWNGVLIDSMLCLKAGSKSQAPCKGDSGGPLVCGKGQVDG 223

  Fly   230 LVNWGWPCATGV--PDVHASVYFYRDWIRNVM 259
            ::::.....|.:  |.|..:|..|..|||.|:
Mouse   224 ILSFSSKTCTDIFKPPVATAVAPYSSWIRKVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/255 (29%)
Tryp_SPc 38..258 CDD:238113 77/257 (30%)
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 77/257 (30%)
Tryp_SPc 27..251 CDD:214473 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.