DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1b1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:290 Identity:77/290 - (26%)
Similarity:131/290 - (45%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            ::|.:.|.|.|:.:...::             .||:||...|....|:.:::.... .:.|||.:
Mouse     4 LILFLALSLGGIDAAPPVQ-------------SRIVGGFKCEKNSQPWHVAVYRYK-EYICGGVL 54

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNK--YNQPGGRYFLKA---IH------IHCN-YDNP-- 119
            ::..:|||||||.......||    |.|.  .::|..::.|.:   :|      :|.| ..||  
Mouse    55 LDANWVLTAAHCYYEKNNVWL----GKNNLYQDEPSAQHRLVSKSFLHPCYNMSLHRNRIQNPQD 115

  Fly   120 EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPI------DLQVLY 178
            :...|:.||.|.:|....:..:||.||....:.|...:.:||||.:     |:      |||.:.
Mouse   116 DYSYDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSII-----PVKFQYAKDLQCVN 175

  Fly   179 LQYVPHRECKALLSNDEDCDVGHICTFSRL---------GEGACHGDSGGPLVSNGYLVGLVNWG 234
            |:.:|          :||||..::...:.:         |:..|.|||||||:.:|.|.||.:||
Mouse   176 LKLLP----------NEDCDKAYVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDGVLQGLTSWG 230

  Fly   235 W-PCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            : ||. ...|.|:..:..:..||::.::.|
Mouse   231 YNPCGEPKKPGVYTKLIKFTSWIKDTLAQN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/248 (28%)
Tryp_SPc 38..258 CDD:238113 71/250 (28%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.