DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1b26

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_034774.1 Gene:Klk1b26 / 16618 MGIID:891981 Length:261 Species:Mus musculus


Alignment Length:283 Identity:78/283 - (27%)
Similarity:127/283 - (44%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            ::|...|.|.|:.:...::             .|::||...|....|:|:::. ....|.|||.:
Mouse     4 LILFPALSLGGIDAAPPLQ-------------SRVVGGFNCEKNSQPWQVAVY-YQKEHICGGVL 54

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNK----------------YNQPGGRYFLKAIHIHCNYD 117
            ::..:|||||||..:.:..||    |.||                :..||  :.:..:.:.....
Mouse    55 LDRNWVLTAAHCYVDQYEVWL----GKNKLFQEEPSAQHRLVSKSFPHPG--FNMSLLMLQTTPP 113

  Fly   118 NPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGS--TVLWGTSPIDLQVLYLQ 180
            ..:..||:.||.|.:|....:..:||.||....:||...:.:||||  ...|..|. |||.:::.
Mouse   114 GADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSTCLASGWGSITPTRWQKSD-DLQCVFIT 177

  Fly   181 YVPHREC-KALLSNDEDCDVGHICTFSRLGEG--ACHGDSGGPLVSNGYLVGLVNWG-WPCA-TG 240
            .:|:..| |..|....|.   .:|. ..:|.|  .|.|||||||:.:|.|.|..:.| .||. .|
Mouse   178 LLPNENCAKVYLQKVTDV---MLCA-GEMGGGKDTCAGDSGGPLICDGILQGTTSNGPEPCGKPG 238

  Fly   241 VPDVHASVYFYRDWIRNVMSGNS 263
            ||.::.::..:..||::.|..|:
Mouse   239 VPAIYTNLIKFNSWIKDTMMKNA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/240 (29%)
Tryp_SPc 38..258 CDD:238113 71/242 (29%)
Klk1b26NP_034774.1 Tryp_SPc 24..253 CDD:214473 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.