DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1b24

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:282 Identity:81/282 - (28%)
Similarity:132/282 - (46%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            ::|.:.|.|.|:.:...::             .|::||...|....|:.:::...: .:.|||.:
Mouse     4 LILFLALSLGGIDAAPPVQ-------------SRVVGGFKCEKNSQPWHVAVFRYN-KYICGGVL 54

  Fly    69 INETFVLTAAHCVENA---FIPWLVVVTGTNK--YNQPGGRY-FLKAIHIHCNY-------DNP- 119
            :|..:|||||||..||   :..||    |.||  ..:|..:: ::.....|.:|       |.| 
Mouse    55 LNPNWVLTAAHCYGNATSQYNVWL----GKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQ 115

  Fly   120 --EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGS--TVLWGTSPIDLQVLYLQ 180
              :..||:.||.|.||....:..:||.||....:.|...:.:||||  ...| ..|.|||.::::
Mouse   116 PKDKSNDLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKW-QKPNDLQCVFIK 179

  Fly   181 YVPHREC-KALLSNDEDCDVGHICTFSRLGEG--ACHGDSGGPLVSNGYLVGLVNWG-WPCA-TG 240
            .:|:..| |..|....|.   .:|. ..:|.|  .|.|||||||:.:|.|.|:.:|| .||. ..
Mouse   180 LLPNENCTKPYLHKVTDV---MLCA-GEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPN 240

  Fly   241 VPDVHASVYFYRDWIRNVMSGN 262
            .|.::..:..:..||::.|:.|
Mouse   241 APAIYTKLIKFASWIKDTMAKN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/240 (30%)
Tryp_SPc 38..258 CDD:238113 74/242 (31%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 73/240 (30%)
Tryp_SPc 25..258 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.