DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1b16

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032480.1 Gene:Klk1b16 / 16615 MGIID:891982 Length:261 Species:Mus musculus


Alignment Length:285 Identity:80/285 - (28%)
Similarity:131/285 - (45%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            ::|.:.|.|.|:.:...::             .||:||...|....|:|:::. ....|.|||.:
Mouse     4 LILFLALSLGGIDAAPPVQ-------------SRIVGGFKCEKNSQPWQVAVY-YHKEHICGGVL 54

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNK--YNQPGGRYFLKAIHIHCNYDNP------------ 119
            ::..:|||||||..:....||    |.|:  ..:|..:..|    :..::.:|            
Mouse    55 LDRNWVLTAAHCYVDECEVWL----GKNQLFQEEPSAQNRL----VSKSFPHPGFNMTLLTFEKL 111

  Fly   120 ----EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGS--TVLWGTSPIDLQVLY 178
                :..||:.||.|.:|....:..:||.||....:.....:::||||  ...| ..|.|||.::
Mouse   112 PPGADFSNDLMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKW-QKPDDLQCMF 175

  Fly   179 LQYVPHREC-KALLSNDEDCDVGHICTFSRLGE--GACHGDSGGPLVSNGYLVGLVNWG-WPCA- 238
            .:.:|:..| ||.|....|.   .:||. .:||  |.|.|||||||:.:|.|.|.|:.| .||. 
Mouse   176 TKLLPNENCAKAYLLKVTDV---MLCTI-EMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGI 236

  Fly   239 TGVPDVHASVYFYRDWIRNVMSGNS 263
            .||..::.::..:..||::.|..|:
Mouse   237 PGVSAIYTNLVKFNSWIKDTMMKNA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/242 (30%)
Tryp_SPc 38..258 CDD:238113 73/244 (30%)
Klk1b16NP_032480.1 Tryp_SPc 25..256 CDD:238113 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.