DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:264 Identity:80/264 - (30%)
Similarity:123/264 - (46%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVEN----AFIPWLVVVTGTNK 97
            ||:||..:.:|..|:|.||| :.|.|.||||:|.:.:|:|||||.:.    :.:.|.|.: |...
Human   567 RIVGGAVSSEGEWPWQASLQ-VRGRHICGGALIADRWVITAAHCFQEDSMASTVLWTVFL-GKVW 629

  Fly    98 YNQ--PGGRYF-LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP--MQPGDEVI 157
            .|.  ||...| :..:.:|..::......|:|||:|..|:......:|:.||...  .:||....
Human   630 QNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCW 694

  Fly   158 LTGWGS-----------TVLWG---------TSPID--LQVLYLQYVPHRECKALLSNDEDCDVG 200
            :||||:           .:.:|         ..||.  ||.:.:|.:|...|..:........: 
Human   695 ITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLCSEVYRYQVTPRM- 758

  Fly   201 HICTFSRLG-EGACHGDSGGPLVSNG-----YLVGLVNWGWPCATGVPD---VHASVYFYRDWIR 256
             :|...|.| :.||.||||||||...     :|.|||:||..|  |.|:   |:..:.....||:
Human   759 -LCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGLVSWGLGC--GRPNYFGVYTRITGVISWIQ 820

  Fly   257 NVMS 260
            .|::
Human   821 QVVT 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/257 (30%)
Tryp_SPc 38..258 CDD:238113 78/259 (30%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 78/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.