DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:253 Identity:82/253 - (32%)
Similarity:124/253 - (49%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIP---WLVVVTGT 95
            :..||:||..|..|..|:|:||. :.|.|.|||:||...:::|||||||.....   | ....|.
  Rat   250 RQSRIVGGSTASPGDWPWQVSLH-VQGIHVCGGSIITPEWIVTAAHCVEEPLSSPRYW-TAFAGI 312

  Fly    96 NKYNQP--GGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG----- 153
            .|.:..  |.|:.::.:..|.|||:...:|||||::|..|:|:::..:|:.||    .||     
  Rat   313 LKQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDVVKPVCLP----NPGMMLDL 373

  Fly   154 -DEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGD 216
             .|..::|||:|...|.:...|....:..:...:|.:....:.......||. |.:....:|.||
  Rat   374 AQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGD 438

  Fly   217 SGGPLVS----NGYLVGLVNWGWPCATGV-PDVHASVYFYRDWIRNVMSGNSKCTGFS 269
            ||||||:    ..:|:|..:||..||... |.|:.:|..:.|||...|...|...|.|
  Rat   439 SGGPLVTLKNEIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYQQMRVISLIPGLS 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/234 (32%)
Tryp_SPc 38..258 CDD:238113 77/236 (33%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133
Tryp_SPc 253..482 CDD:214473 76/234 (32%)
Tryp_SPc 254..485 CDD:238113 77/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.