DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CTRL

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:279 Identity:86/279 - (30%)
Similarity:137/279 - (49%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :|..:.|:|||.|....|.||:       ......|||:.|:.|..|..|:|:|||..||.|.||
Human     4 LSLTLSLVLLGSSWGCGIPAIK-------PALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCG 61

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI-----HCNYDNPEMHNDI 125
            |::|::::|:|||||  |.......||.|  :|::......|:.:.:     |.::::..|:||:
Human    62 GSLISQSWVVTAAHC--NVSPGRHFVVLG--EYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDV 122

  Fly   126 ALLELVEPIAWDERTQPIPLPL--VPMQPGDEVILTGWGS-TVLWGTSPIDLQVLYLQYVPHREC 187
            .||:|..|..:..|..|:.|..  ..:..|...:.||||. :.:...:|..||.:.|..|...:|
Human   123 TLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQC 187

  Fly   188 K----ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWP-CATGVPD 243
            :    :.:::...|..|       .|..:|.||||||||    :...|:|:|:||.. |....|.
Human   188 RQYWGSSITDSMICAGG-------AGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPA 245

  Fly   244 VHASVYFYRDWIRNVMSGN 262
            |:..|..:..||..|::.|
Human   246 VYTRVSKFSTWINQVIAYN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/234 (31%)
Tryp_SPc 38..258 CDD:238113 73/236 (31%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.