DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CTRB1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:281 Identity:92/281 - (32%)
Similarity:136/281 - (48%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLV---SITAIR--IKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISG 60
            |:::.||....|.|..   .:.||.  :.|.|         ||:.|:.|..|..|:|:|||..:|
Human     1 MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLS---------RIVNGEDAVPGSWPWQVSLQDKTG 56

  Fly    61 AHSCGGAIINETFVLTAAHC-VENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPE---- 120
            .|.|||::|:|.:|:||||| |..:.    |||.|  :::|......::.:.|...:.||:    
Human    57 FHFCGGSLISEDWVVTAAHCGVRTSD----VVVAG--EFDQGSDEENIQVLKIAKVFKNPKFSIL 115

  Fly   121 -MHNDIALLELVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGSTVL-WGTSPIDLQVLYLQY 181
             ::|||.||:|..|..:.:....:.||..  ....|.....||||.|.. ...:|..||...|..
Human   116 TVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL 180

  Fly   182 VPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV--SNG--YLVGLVNWGW-PCATGV 241
            :.:.|||..... ...|| .||. ...|..:|.||||||||  .:|  .|||:|:||. .|:|..
Human   181 LSNAECKKSWGR-RITDV-MICA-GASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSS 242

  Fly   242 PDVHASVYFYRDWIRNVMSGN 262
            |.|:|.|.....|::.:::.|
Human   243 PGVYARVTKLIPWVQKILAAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/231 (35%)
Tryp_SPc 38..258 CDD:238113 81/233 (35%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 81/231 (35%)
Tryp_SPc 34..259 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.