DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG43742

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:250 Identity:67/250 - (26%)
Similarity:111/250 - (44%) Gaps:53/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHS-----CGGAIINETFVLTAAHCVENAFIPWLVVVTGTN 96
            |:..|..|        |:.|.::..::     |||::|::.:||||||||.:  :..:.|..|.|
  Fly    34 RVANGHTA--------ITSQFMAALYNNSEFFCGGSLIHKQYVLTAAHCVRD--LDEVTVHLGEN 88

  Fly    97 KYN--QPGGRYFLK---AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEV 156
            ..:  .|..::.|:   .:.:|.|:......||||||.|...:.::...:||.:.|      ||.
  Fly    89 NRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIIL------DED 147

  Fly   157 ILT---------GWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGA 212
            :.:         |||.|.....|.: |..:.|..:|...|..        ::..||..|..|: .
  Fly   148 VTSNNQNNFTAYGWGKTEHGNISDV-LSFIDLVRLPKSMCYQ--------NINTICAGSTSGD-T 202

  Fly   213 CHGDSGGPLVSN--------GYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVM 259
            |..||||||:.|        ..|.|:.::|....:|:..|:..|..|:.||.:|:
  Fly   203 CESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/244 (26%)
Tryp_SPc 38..258 CDD:238113 65/246 (26%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 64/244 (26%)
Tryp_SPc 35..256 CDD:238113 65/246 (26%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.