DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:272 Identity:94/272 - (34%)
Similarity:132/272 - (48%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAA 78
            |..|...:.:|.::...|.....||:||..:.....|:|:||| ..|.|.|||:||...:::|||
Mouse   215 GCTSGHVVTLKCSACGTRTGYSPRIVGGNMSSLTQWPWQVSLQ-FQGYHLCGGSIITPLWIVTAA 278

  Fly    79 HCVENAFIP--WLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQ 141
            |||.:.:.|  |.|.|...:..:.|...:.::.|..|..|....:.|||||::|.||:.:||..|
Mouse   279 HCVYDLYHPKSWTVQVGLVSLMDSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQ 343

  Fly   142 PIPLPLVPMQ-PGDEVILT-GWGSTVLWG-TSPIDLQVLYLQYVPHRECKALLSNDEDC---DV- 199
            ||.||..... |..::..| |||:|...| .||    ||....||      |:|| :.|   || 
Mouse   344 PICLPNSEENFPDGKLCWTSGWGATEDGGDASP----VLNHAAVP------LISN-KICNHRDVY 397

  Fly   200 GHICTFSRL-------GEGACHGDSGGPLVSN----GYLVGLVNWGWPCA-TGVPDVHASVYFYR 252
            |.|.:.|.|       |..:|.||||||||..    ..|||..::|..|| ...|.|:..:..:.
Mouse   398 GGIISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFL 462

  Fly   253 DWIRNVMSGNSK 264
            |||...:..:.|
Mouse   463 DWIHEQLERDLK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 87/238 (37%)
Tryp_SPc 38..258 CDD:238113 88/240 (37%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 3/17 (18%)
Tryp_SPc 238..465 CDD:214473 87/238 (37%)
Tryp_SPc 239..468 CDD:238113 88/240 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.